TESK2 monoclonal antibody (M04), clone 5H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TESK2.
Immunogen
TESK2 (AAH33085, 405 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GPGTMPLADWQEPLAPPIRRWCSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSGIGLQTQGKQDG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (84)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.81 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TESK2 expression in transfected 293T cell line by TESK2 monoclonal antibody (M04), clone 5H4.
Lane 1: TESK2 transfected lysate(60.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TESK2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TESK2 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TESK2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TESK2
Entrez GeneID
10420GeneBank Accession#
BC033085Protein Accession#
AAH33085Gene Name
TESK2
Gene Alias
-
Gene Description
testis-specific kinase 2
Omim ID
604746Gene Ontology
HyperlinkGene Summary
This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overall structure is most related to the former, indicating that it belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. This gene is predominantly expressed in testis and prostate. The developmental expression pattern of the rat gene in testis suggests an important role for this gene in meitoic stages and/or early stages of spermiogenesis. [provided by RefSeq
Other Designations
OTTHUMP00000009093|testis-specific protein kinase 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com