YAP1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human YAP1 full-length ORF ( AAH38235.1, 1 a.a. - 504 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
80.9
Interspecies Antigen Sequence
Mouse (85)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — YAP1
Entrez GeneID
10413GeneBank Accession#
BC038235.1Protein Accession#
AAH38235.1Gene Name
YAP1
Gene Alias
YAP, YAP2, YAP65, YKI
Gene Description
Yes-associated protein 1, 65kDa
Omim ID
606608Gene Ontology
HyperlinkGene Summary
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq
Other Designations
yes-associated protein 2
-
Interactome
-
Disease
-
Publication Reference
-
CCT3 acts upstream of YAP and TFCP2 as a potential target and tumour biomarker in liver cancer.
Liu Y, Zhang X, Lin J, Chen Y, Qiao Y, Guo S, Yang Y, Zhu G, Pan Q, Wang J, Sun F.
Cell Death & Disease 2019 Sep; 10(9):644.
Application:IF, IP-WB, WB-Tr, Human, Bel-7402, SMMC-7721 cells.
-
New Therapeutic Approach for Targeting Hippo Signalling Pathway.
Dominguez-Berrocal L, Cirri E, Zhang X, Andrini L, Marin GH, Lebel-Binay S, Rebollo A.
Scientific Reports 2019 Mar; 9(1):4771.
Application:PI, WB-Re, Recombinant proteins.
-
A Platform of Synthetic Lethal Gene Interaction Networks Reveals that the GNAQ Uveal Melanoma Oncogene Controls the Hippo Pathway through FAK.
Xiaodong Feng, Nadia Arang, Damiano Cosimo Rigiracciolo, Joo Sang Lee, Huwate Yeerna, Zhiyong Wang, Simone Lubrano, Ayush Kishore, Jonathan A Pachter, Gabriele M König, Marcello Maggiolini, Evi Kostenis, David D Schlaepfer, Pablo Tamayo, Qianming Chen, Eytan Ruppin, J Silvio Gutkind.
Cancer Cell 2019 Mar; 35(3):457.
Application:KA, N/A, Recombinant proteins.
-
Nicotine Activates YAP1 through nAChRs Mediated Signaling in Esophageal Squamous Cell Cancer (ESCC).
Zhao Y, Zhou W, Xue L, Zhang W, Zhan Q.
PLoS One 2014 Mar; 9(3):e90836.
Application:Pull-Down, KA, Human, KYSE510 cell.
-
Yap1 acts downstream of α-catenin to control epidermal proliferation.
Karin Schlegelmilch, Morvarid Mohseni, Oktay Kirak, Jan Pruszak, J Renato Rodriguez, Dawang Zhou, Bridget T Kreger, Valera Vasioukhin, Joseph Avruch, Thijn R Brummelkamp, Fernando D Camargo.
Cell 2011 Mar; 144(5):782.
Application:Pull-Down, N/A, Recombinant proteins.
-
CCT3 acts upstream of YAP and TFCP2 as a potential target and tumour biomarker in liver cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com