IFITM3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IFITM3 full-length ORF ( AAH06794, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
40.37
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IFITM3
Entrez GeneID
10410GeneBank Accession#
BC006794Protein Accession#
AAH06794Gene Name
IFITM3
Gene Alias
1-8U, IP15
Gene Description
interferon induced transmembrane protein 3 (1-8U)
Omim ID
605579Gene Ontology
HyperlinkOther Designations
interferon-induced transmembrane protein 3 (1-8U)|interferon-inducible
-
Interactome
-
Disease
-
Publication Reference
-
Cholesterol Binds the Amphipathic Helix of IFITM3 and Regulates Antiviral Activity.
Kazi Rahman, Siddhartha A K Datta, Andrew H Beaven, Abigail A Jolley, Alexander J Sodt, Alex A Compton.
Journal of Molecular Biology 2022 Oct; 434(19):167759.
Application:WB-Ce, Recombinant proteins.
-
IFITM3 functions as a PIP3 scaffold to amplify PI3K signalling in B cells.
Jaewoong Lee, Mark E Robinson, Ning Ma, Dewan Artadji, Mohamed A Ahmed, Gang Xiao, Teresa Sadras, Gauri Deb, Janet Winchester, Kadriye Nehir Cosgun, Huimin Geng, Lai N Chan, Kohei Kume, Teemu P Miettinen, Ye Zhang, Matthew A Nix, Lars Klemm, Chun Wei Chen, Jianjun Chen, Vishal Khairnar, Arun P Wiita,Andrei Thomas-Tikhonenko, Michael Farzan, Jae U Jung, David M Weinstock, Scott R Manalis, Michael S Diamond, Nagarajan Vaidehi, Markus Müschen.
Nature 2020 Dec; 588(7838):491.
Application:Func, WB-Re, Recombinant proteins.
-
Identification of the IFITM3 gene as an inhibitor of hepatitis C viral translation in a stable STAT1 cell line.
Yao L, Dong H, Zhu H, Nelson D, Liu C, Lambiase L, Li X.
Journal of Viral Hepatitis 2011 Oct; 18(10):e523.
Application:Func , Human, HeLa cells.
-
Cholesterol Binds the Amphipathic Helix of IFITM3 and Regulates Antiviral Activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com