IFITM3 monoclonal antibody (M01), clone 4C8-1B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant IFITM3.
Immunogen
IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.37 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IFITM3 monoclonal antibody (M01), clone 4C8-1B10 Western Blot analysis of IFITM3 expression in Hela ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IFITM3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — IFITM3
Entrez GeneID
10410GeneBank Accession#
BC006794Protein Accession#
AAH06794Gene Name
IFITM3
Gene Alias
1-8U, IP15
Gene Description
interferon induced transmembrane protein 3 (1-8U)
Omim ID
605579Gene Ontology
HyperlinkOther Designations
interferon-induced transmembrane protein 3 (1-8U)|interferon-inducible
-
Interactome
-
Disease
-
Publication Reference
-
IFITM3 knockdown reduces the expression of CCND1 and CDK4 and suppresses the growth of oral squamous cell carcinoma cells.
Gan CP, Sam KK, Yee PS, Zainal NS, Lee BKB, Abdul Rahman ZA, Patel V, Tan AC, Zain RB, Cheong SC.
Cellular Oncology (Dordrecht) 2019 Aug; 42(4):477.
Application:IHC-P, WB-Tr, Human, Human oral squamous cell carcinoma, ORL-150, ORL-204 cells.
-
KLF4-Mediated Negative Regulation of IFITM3 Expression Plays a Critical Role in Colon Cancer Pathogenesis.
Li D, Peng Z, Tang H, Wei P, Kong X, Yan D, Huang F, Li Q, Le X, Li Q, Xie K.
Clinical Cancer Research 2011 Jun; 17(11):3558.
Application:IF, IHC-P, WB-Ti, WB-Tr, Human, Mouse, HCT-116 cells, Human colon cancer, Mouse colon mucosa, SW480 cells.
-
Gene-expression profiling in Chinese patients with colon cancer by coupling experimental and bioinformatic genomewide gene-expression analyses: identification and validation of IFITM3 as a biomarker of early colon carcinogenesis.
Fan J, Peng Z, Zhou C, Qiu G, Tang H, Sun Y, Wang X, Li Q, Le X, Xie K.
Cancer 2008 Jul; 113(2):266.
Application:IHC-P, Human, Human colon cancer.
-
Interactions between PBEF and oxidative stress proteins - A potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
Zhang LQ, Adyshev DM, Singleton P, Li H, Cepeda J, Huang SY, Zou X, Verin AD, Tu J, Garcia JG, Ye SQ.
FEBS Letters 2008 May; 582(13):1802.
Application:WB, Human, Human primary pulmonary artery endothelial cells, Human primary lung microvascular endothelial cells.
-
IFITM3 knockdown reduces the expression of CCND1 and CDK4 and suppresses the growth of oral squamous cell carcinoma cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com