IFITM3 MaxPab rabbit polyclonal antibody (D03)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in mouse lung.
Western Blot (Tissue lysate)
IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in human liver.
Western Blot (Cell lysate)
IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T01) by IFITM3 MaxPab polyclonal antibody.
Lane 1: IFITM3 transfected lysate(14.74 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IFITM3 transfected lysate using anti-IFITM3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with IFITM3 purified MaxPab mouse polyclonal antibody (B01P) (H00010410-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IFITM3 protein.
Immunogen
IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length human protein.
Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in mouse lung.Western Blot (Tissue lysate)
IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in human liver.Western Blot (Cell lysate)
IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T01) by IFITM3 MaxPab polyclonal antibody.
Lane 1: IFITM3 transfected lysate(14.74 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IFITM3 transfected lysate using anti-IFITM3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with IFITM3 purified MaxPab mouse polyclonal antibody (B01P) (H00010410-B01P). -
Gene Info — IFITM3
Entrez GeneID
10410GeneBank Accession#
BC006794Protein Accession#
AAH06794Gene Name
IFITM3
Gene Alias
1-8U, IP15
Gene Description
interferon induced transmembrane protein 3 (1-8U)
Omim ID
605579Gene Ontology
HyperlinkOther Designations
interferon-induced transmembrane protein 3 (1-8U)|interferon-inducible
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com