Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFITM3 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00010410-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human IFITM3 protein.
  • Immunogen:
  • IFITM3 (NP_066362.1, 1 a.a. ~ 133 a.a) full-length human protein.
  • Sequence:
  • MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in human placenta.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in K-562.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T02) by IFITM3 MaxPab polyclonal antibody.

    Lane 1: IFITM3 transfected lysate(14.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of IFITM3 transfected lysate using anti-IFITM3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IFITM3 purified MaxPab mouse polyclonal antibody (B02P) (H00010410-B02P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • IFITM3
  • Gene Alias:
  • 1-8U,IP15
  • Gene Description:
  • interferon induced transmembrane protein 3 (1-8U)
  • Other Designations:
  • interferon-induced transmembrane protein 3 (1-8U),interferon-inducible
  • RSS
  • YouTube
  • Linkedin
  • Facebook