IFITM3 MaxPab mouse polyclonal antibody (B02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
IFITM3 MaxPab polyclonal antibody. Western Blot analysis of IFITM3 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T02) by IFITM3 MaxPab polyclonal antibody.
Lane 1: IFITM3 transfected lysate(14.63 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IFITM3 protein.
Immunogen
IFITM3 (NP_066362.1, 1 a.a. ~ 133 a.a) full-length human protein.
Sequence
MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
IFITM3 MaxPab polyclonal antibody. Western Blot analysis of IFITM3 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T02) by IFITM3 MaxPab polyclonal antibody.
Lane 1: IFITM3 transfected lysate(14.63 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IFITM3
Entrez GeneID
10410GeneBank Accession#
NM_021034.1Protein Accession#
NP_066362.1Gene Name
IFITM3
Gene Alias
1-8U, IP15
Gene Description
interferon induced transmembrane protein 3 (1-8U)
Omim ID
605579Gene Ontology
HyperlinkOther Designations
interferon-induced transmembrane protein 3 (1-8U)|interferon-inducible
-
Interactome
-
Disease
-
Publication Reference
-
The N-terminal region of IFITM3 modulates its antiviral activity by regulating IFITM3 cellular localization.
Jia R, Pan Q, Ding S, Rong L, Liu SL, Geng Y, Qiao W, Liang C.
Journal of Virology 2012 Dec; 86(24):13697.
Application：IP, WB-Tr, Human, HeLa cells.
-
Evidence for Alteration of Gene Regulatory Networks through MicroRNAs of the HIV-Infected Brain: Novel Analysis of Retrospective Cases.
Tatro ET, Scott ER, Nguyen TB, Salaria S, Banerjee S, Moore DJ, Masliah E, Achim CL, Everall IP.
PLoS One 2010 Apr; 5(4):e10337.
Application：WB-Tr, Human, Human neuronal cells.
-
The N-terminal region of IFITM3 modulates its antiviral activity by regulating IFITM3 cellular localization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com