Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BASP1 (Human) Recombinant Protein (P01)

  • Catalog # : H00010409-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BASP1 full-length ORF ( NP_006308.3, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAPAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPLRGGEAPKAAEAAAGPRPRAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010409-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • BASP1
  • Gene Alias:
  • CAP-23,CAP23,MGC8555,NAP-22,NAP22
  • Gene Description:
  • brain abundant, membrane attached signal protein 1
  • Gene Summary:
  • This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. [provided by RefSeq
  • Other Designations:
  • brain acid-soluble protein 1,neuronal axonal membrane protein NAP-22,neuronal tissue-enriched acidic protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook