BASP1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BASP1 full-length ORF ( NP_006308.3, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAPAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPLRGGEAPKAAEAAAGPRPRAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
50.6
Interspecies Antigen Sequence
Mouse (68); Rat (62)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BASP1
Entrez GeneID
10409GeneBank Accession#
NM_006317.1Protein Accession#
NP_006308.3Gene Name
BASP1
Gene Alias
CAP-23, CAP23, MGC8555, NAP-22, NAP22
Gene Description
brain abundant, membrane attached signal protein 1
Omim ID
605940Gene Ontology
HyperlinkGene Summary
This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. [provided by RefSeq
Other Designations
brain acid-soluble protein 1|neuronal axonal membrane protein NAP-22|neuronal tissue-enriched acidic protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com