Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WFDC2 (Human) Recombinant Protein (P01)

  • Catalog # : H00010406-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human WFDC2 full-length ORF ( AAH46106.1, 31 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.08
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010406-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • WFDC2
  • Gene Alias:
  • HE4,MGC57529,WAP5,dJ461P17.6
  • Gene Description:
  • WAP four-disulfide core domain 2
  • Gene Summary:
  • This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031141,WAP domain containing protein HE4-V4,epididymal secretory protein E4,epididymis-specific, whey-acidic protein type, four-disulfide core,major epididymis-specific protein E4
  • RSS
  • YouTube
  • Linkedin
  • Facebook