WFDC2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human WFDC2 full-length ORF ( AAH46106.1, 31 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Interspecies Antigen Sequence
Mouse (44); Rat (43)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — WFDC2
Entrez GeneID
10406GeneBank Accession#
BC046106Protein Accession#
AAH46106.1Gene Name
WFDC2
Gene Alias
HE4, MGC57529, WAP5, dJ461P17.6
Gene Description
WAP four-disulfide core domain 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq
Other Designations
OTTHUMP00000031141|WAP domain containing protein HE4-V4|epididymal secretory protein E4|epididymis-specific, whey-acidic protein type, four-disulfide core|major epididymis-specific protein E4
-
Interactome
-
Publication Reference
-
Selection of DNA aptamers for ovarian cancer biomarker HE4 using CE-SELEX and high-throughput sequencing.
Eaton RM, Shallcross JA, Mael LE, Mears KS, Minkoff L, Scoville DJ, Whelan RJ.
Analytical and Bioanalytical Chemistry 2015 Sep; 407(23):6965.
Application：Func, FAM-labeled aptamer.
-
Selection of DNA aptamers for ovarian cancer biomarker HE4 using CE-SELEX and high-throughput sequencing.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com