WFDC2 monoclonal antibody (M01), clone 3F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant WFDC2.
Immunogen
WFDC2 (AAH46106.1, 31 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (44); Rat (43)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WFDC2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — WFDC2
Entrez GeneID
10406GeneBank Accession#
BC046106Protein Accession#
AAH46106.1Gene Name
WFDC2
Gene Alias
HE4, MGC57529, WAP5, dJ461P17.6
Gene Description
WAP four-disulfide core domain 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq
Other Designations
OTTHUMP00000031141|WAP domain containing protein HE4-V4|epididymal secretory protein E4|epididymis-specific, whey-acidic protein type, four-disulfide core|major epididymis-specific protein E4
-
Interactome
-
Publication Reference
-
Detection of serum human epididymis secretory protein 4 in patients with ovarian cancer using a label-free biosensor based on localized surface plasmon resonance.
Yuan J, Duan R, Yang H, Luo X, Xi M.
International Journal of Nanomedicine 2012 Jun; 7:2921.
Application:Func, ELISA, Human, Human serum specimens.
-
Detection of serum human epididymis secretory protein 4 in patients with ovarian cancer using a label-free biosensor based on localized surface plasmon resonance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com