Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST3GAL6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010402-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ST3GAL6 partial ORF ( NP_006091, 145 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010402-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ST3GAL6
  • Gene Alias:
  • SIAT10,ST3GALVI
  • Gene Description:
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 6
  • Gene Summary:
  • Sialyltransferases, such as ST3GAL6, catalyze the transfer of sialic acid from cytidine 5-prime monophospho-N-acetylneuraminic acid (CMP-NeuAc) to terminal positions of glycoprotein and glycolipid carbohydrate groups. Terminal NeuAc residues are key determinants of carbohydrate structures, such as the sialyl-Lewis X determinants, and are widely distributed in many cell types.[supplied by OMIM
  • Other Designations:
  • alpha2,3-sialyltransferase,alpha2,3-sialyltransferase VI,sialyltransferase 10 (alpha-2,3-sialyltransferase VI)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook