BPNT1 monoclonal antibody (M01), clone 2E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BPNT1 monoclonal antibody (M01), clone 2E1 Western Blot analysis of BPNT1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of BPNT1 expression in transfected 293T cell line by BPNT1 monoclonal antibody (M01), clone 2E1.
Lane 1: BPNT1 transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BPNT1 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to BPNT1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BPNT1.
Immunogen
BPNT1 (NP_006076, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BPNT1 monoclonal antibody (M01), clone 2E1 Western Blot analysis of BPNT1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of BPNT1 expression in transfected 293T cell line by BPNT1 monoclonal antibody (M01), clone 2E1.
Lane 1: BPNT1 transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BPNT1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to BPNT1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — BPNT1
Entrez GeneID
10380GeneBank Accession#
NM_006085Protein Accession#
NP_006076Gene Name
BPNT1
Gene Alias
PIP
Gene Description
3'(2'), 5'-bisphosphate nucleotidase 1
Omim ID
604053Gene Ontology
HyperlinkGene Summary
BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq
Other Designations
BPntase|OTTHUMP00000035564|PAP-inositol-1,4-phosphatase|bisphosphate 3'-nucleotidase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com