Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEMA3A (Human) Recombinant Protein (Q01)

  • Catalog # : H00010371-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SEMA3A partial ORF ( NP_006071, 672 a.a. - 770 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010371-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SEMA3A
  • Gene Alias:
  • Hsema-I,Hsema-III,MGC133243,SEMA1,SEMAD,SEMAIII,SEMAL,SemD,coll-1
  • Gene Description:
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
  • Gene Summary:
  • This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease. [provided by RefSeq
  • Other Designations:
  • collapsin 1,semaphorin 3A,semaphorin D,semaphorin III,semaphorin L,semaphorin-like
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook