Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KLF2 polyclonal antibody (A01)

  • Catalog # : H00010365-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KLF2.
  • Immunogen:
  • KLF2 (NP_057354, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010365-A01
    Western Blot detection against Immunogen (32.27 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLF2 polyclonal antibody (A01), Lot # HMS31060314QCS1. Western Blot analysis of KLF2 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • KLF2
  • Gene Alias:
  • LKLF
  • Gene Description:
  • Kruppel-like factor 2 (lung)
  • Other Designations:
  • Kruppel-like factor,Kruppel-like factor LKLF,lung Kruppel-like zinc finger transcription factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook