Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NPM3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00010360-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NPM3 protein.
  • Immunogen:
  • NPM3 (NP_008924.1, 1 a.a. ~ 178 a.a) full-length human protein.
  • Sequence:
  • MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NPM3 expression in transfected 293T cell line (H00010360-T01) by NPM3 MaxPab polyclonal antibody.

    Lane1:NPM3 transfected lysate(19.58 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NPM3
  • Gene Alias:
  • PORMIN,TMEM123
  • Gene Description:
  • nucleophosmin/nucleoplasmin, 3
  • Gene Summary:
  • The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020352,nucleophosmin/nucleoplasmin 3,nucleophosmin/nucleoplasmin family, member 3,nucleoplasmin-3
  • RSS
  • YouTube
  • Linkedin
  • Facebook