WARS2 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human WARS2 protein.
Immunogen
WARS2 (NP_957715.1, 1 a.a. ~ 220 a.a) full-length human protein.
Sequence
MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILSMCVLVFLT
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WARS2 expression in transfected 293T cell line (H00010352-T02) by WARS2 MaxPab polyclonal antibody.
Lane 1: WARS2 transfected lysate(24.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of WARS2 transfected lysate using anti-WARS2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with WARS2 purified MaxPab mouse polyclonal antibody (B01P) (H00010352-B01P). -
Gene Info — WARS2
Entrez GeneID
10352GeneBank Accession#
NM_201263.1Protein Accession#
NP_957715.1Gene Name
WARS2
Gene Alias
TrpRS
Gene Description
tryptophanyl tRNA synthetase 2, mitochondrial
Omim ID
604733Gene Ontology
HyperlinkGene Summary
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000014272|OTTHUMP00000014273|mitochondrial tryptophanyl tRNA synthetase 2|tryptophan tRNA ligase 2, mitochondrial|tryptophan-tRNA ligase
-
Interactome
-
Pathway
-
Publication Reference
-
Expression of the rodent-specific alternative splice variant of tryptophanyl-tRNA synthetase in murine tissues and cells.
Miyanokoshi M, Tanaka T, Tamai M, Tagawa Y, Wakasugi K.
Scientific Reports 2013 Dec; 3:3477.
Application:WB, Mouse, ES cells.
-
Expression of the rodent-specific alternative splice variant of tryptophanyl-tRNA synthetase in murine tissues and cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com