Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL26 (Human) Recombinant Protein (P01)

  • Catalog # : H00010344-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL26 full-length ORF ( NP_006063.1, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010344-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CCL26
  • Gene Alias:
  • IMAC,MGC126714,MIP-4a,MIP-4alpha,SCYA26,TSC-1
  • Gene Description:
  • chemokine (C-C motif) ligand 26
  • Gene Summary:
  • This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq
  • Other Designations:
  • CC chemokine IMAC,chemokine N1,eotaxin-3,macrophage inflammatory protein 4-alpha,small inducible cytokine A26,small inducible cytokine subfamily A (Cys-Cys), member 26,thymic stroma chemokine-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook