CCL26 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCL26 full-length ORF ( NP_006063.1, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCL26
Entrez GeneID
10344GeneBank Accession#
NM_006072.4Protein Accession#
NP_006063.1Gene Name
CCL26
Gene Alias
IMAC, MGC126714, MIP-4a, MIP-4alpha, SCYA26, TSC-1
Gene Description
chemokine (C-C motif) ligand 26
Omim ID
604697Gene Ontology
HyperlinkGene Summary
This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq
Other Designations
CC chemokine IMAC|chemokine N1|eotaxin-3|macrophage inflammatory protein 4-alpha|small inducible cytokine A26|small inducible cytokine subfamily A (Cys-Cys), member 26|thymic stroma chemokine-1
-
Interactome
-
Pathway
-
Disease
- Arthritis
- Asthma
- Birth Weight
- Bronchiolitis
- Colitis
- Genetic Predisposition to Disease
- Glioblastoma
- Glioma
- HIV Infections
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com