CCL26 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCL26 expression in transfected 293T cell line (H00010344-T01) by CCL26 MaxPab polyclonal antibody.
Lane 1: CCL26 transfected lysate(10.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCL26 protein.
Immunogen
CCL26 (NP_006063.1, 1 a.a. ~ 94 a.a) full-length human protein.
Sequence
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCL26 expression in transfected 293T cell line (H00010344-T01) by CCL26 MaxPab polyclonal antibody.
Lane 1: CCL26 transfected lysate(10.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCL26
Entrez GeneID
10344GeneBank Accession#
NM_006072Protein Accession#
NP_006063.1Gene Name
CCL26
Gene Alias
IMAC, MGC126714, MIP-4a, MIP-4alpha, SCYA26, TSC-1
Gene Description
chemokine (C-C motif) ligand 26
Omim ID
604697Gene Ontology
HyperlinkGene Summary
This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq
Other Designations
CC chemokine IMAC|chemokine N1|eotaxin-3|macrophage inflammatory protein 4-alpha|small inducible cytokine A26|small inducible cytokine subfamily A (Cys-Cys), member 26|thymic stroma chemokine-1
-
Interactome
-
Pathway
-
Disease
- Arthritis
- Asthma
- Birth Weight
- Bronchiolitis
- Colitis
- Genetic Predisposition to Disease
- Glioblastoma
- Glioma
- HIV Infections
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com