Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL26 polyclonal antibody (A01)

  • Catalog # : H00010344-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CCL26.
  • Immunogen:
  • CCL26 (NP_006063, 24 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010344-A01
    Western Blot detection against Immunogen (33.92 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CCL26
  • Gene Alias:
  • IMAC,MGC126714,MIP-4a,MIP-4alpha,SCYA26,TSC-1
  • Gene Description:
  • chemokine (C-C motif) ligand 26
  • Gene Summary:
  • This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq
  • Other Designations:
  • CC chemokine IMAC,chemokine N1,eotaxin-3,macrophage inflammatory protein 4-alpha,small inducible cytokine A26,small inducible cytokine subfamily A (Cys-Cys), member 26,thymic stroma chemokine-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook