Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCGF3 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00010336-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PCGF3 protein.
  • Immunogen:
  • PCGF3 (NP_006306.2, 1 a.a. ~ 242 a.a) full-length human protein.
  • Sequence:
  • MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PCGF3 expression in transfected 293T cell line (H00010336-T01) by PCGF3 MaxPab polyclonal antibody.

    Lane 1: PCGF3 transfected lysate(26.62 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • PCGF3
  • Gene Alias:
  • DKFZp686D20235,DONG1,FLJ36550,FLJ43813,MGC129615,MGC40413,RNF3,RNF3A
  • Gene Description:
  • polycomb group ring finger 3
  • Gene Summary:
  • The protein encoded by this gene contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000147527,ring finger protein 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook