COX4NB monoclonal antibody (M01), clone 4F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
COX4NB monoclonal antibody (M01), clone 4F4. Western Blot analysis of COX4NB expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of COX4NB expression in transfected 293T cell line by COX4NB monoclonal antibody (M01), clone 4F4.
Lane 1: COX4NB transfected lysate (Predicted MW: 23.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COX4NB is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant COX4NB.
Immunogen
COX4NB (NP_006058.1, 113 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COX4NB monoclonal antibody (M01), clone 4F4. Western Blot analysis of COX4NB expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of COX4NB expression in transfected 293T cell line by COX4NB monoclonal antibody (M01), clone 4F4.
Lane 1: COX4NB transfected lysate (Predicted MW: 23.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COX4NB is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — COX4NB
Entrez GeneID
10328GeneBank Accession#
NM_006067Protein Accession#
NP_006058.1Gene Name
COX4NB
Gene Alias
C16orf2, C16orf4, FAM158B, NOC4
Gene Description
COX4 neighbor
Omim ID
604886Gene Ontology
HyperlinkGene Summary
member B|neighbor of COX4
Other Designations
family with sequence similarity 158, member B|neighbor of COX4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com