B3GALT5 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant B3GALT5.
Immunogen
B3GALT5 (NP_006048, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Sequence
NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (62); Rat (61)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — B3GALT5
Entrez GeneID
10317GeneBank Accession#
NM_006057Protein Accession#
NP_006048Gene Name
B3GALT5
Gene Alias
B3GalT-V, B3GalTx, B3T5, GLCT5, beta3Gal-T5
Gene Description
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Omim ID
604066Gene Ontology
HyperlinkGene Summary
This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene encodes the most probable candidate for synthesis of the type 1 Lewis antigens which are frequently found to be elevated in gastrointestinal and pancreatic cancers. The encoded protein is inactive with N-linked glycoproteins and functions in mucin glycosylation. Five transcript variants have been described which differ in the 5' UTR. All transcript variants encode an identical protein. [provided by RefSeq
Other Designations
GlcNAc-beta-1,3-galactosyltransferase 5|OTTHUMP00000109185|OTTHUMP00000109186|UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 5|homolog of C. elegans Bt toxin resistance gene bre-5
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com