LANCL1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LANCL1 partial ORF ( NP_006046, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.12
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LANCL1
Entrez GeneID
10314GeneBank Accession#
NM_006055Protein Accession#
NP_006046Gene Name
LANCL1
Gene Alias
GPR69A, p40
Gene Description
LanC lantibiotic synthetase component C-like 1 (bacterial)
Omim ID
604155Gene Ontology
HyperlinkGene Summary
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
G protein-coupled receptor 69A|LanC (bacterial lantibiotic synthetase component C)-like 1|LanC (bacterial lantibiotic synthetase component)|lanthionine synthetase C-like protein 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com