Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LANCL1 polyclonal antibody (A01)

  • Catalog # : H00010314-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LANCL1.
  • Immunogen:
  • LANCL1 (NP_006046, 1 a.a. ~ 58 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • LANCL1 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of LANCL1 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • LANCL1
  • Gene Alias:
  • GPR69A,p40
  • Gene Description:
  • LanC lantibiotic synthetase component C-like 1 (bacterial)
  • Gene Summary:
  • This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • G protein-coupled receptor 69A,LanC (bacterial lantibiotic synthetase component C)-like 1,LanC (bacterial lantibiotic synthetase component),lanthionine synthetase C-like protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook