LANCL1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
LANCL1 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of LANCL1 expression in human ovarian cancer.
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant LANCL1.
Immunogen
LANCL1 (NP_006046, 1 a.a. ~ 58 a.a) partial recombinant protein with GST tag.
Sequence
MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LANCL1 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of LANCL1 expression in human ovarian cancer.ELISA
-
Gene Info — LANCL1
Entrez GeneID
10314GeneBank Accession#
NM_006055Protein Accession#
NP_006046Gene Name
LANCL1
Gene Alias
GPR69A, p40
Gene Description
LanC lantibiotic synthetase component C-like 1 (bacterial)
Omim ID
604155Gene Ontology
HyperlinkGene Summary
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
G protein-coupled receptor 69A|LanC (bacterial lantibiotic synthetase component C)-like 1|LanC (bacterial lantibiotic synthetase component)|lanthionine synthetase C-like protein 1
-
Interactome
-
Publication Reference
-
LANCL1, a cell surface protein, promotes liver tumor initiation through FAM49B-Rac1 axis to suppress oxidative stress.
Hongyang Huang, Yu-Man Tsui, Daniel Wai-Hung Ho, Clive Yik-Sham Chung, Karen Man-Fong Sze, Eva Lee, Gary Cheuk-Hang Cheung, Vanilla Xin Zhang, Xia Wang, Xueying Lyu, Irene Oi-Lin Ng
Hepatology 2023 Aug; [Epub]:0.
Application：Stimulation, Human, PLC/PRF/5 cells.
-
Lantibiotic Cyclase-like protein 2 (LanCL2) is a novel regulator of Akt.
Zeng M, van der Donk WA, Chen J.
Molecular Biology of the Cell 2014 Dec; 25(24):3954.
Application：WB-Ce, WB-Tr, Human, HepG2, Hep3B, HEK293, Ea1C-35, THLE-2, MCF7, HeLa cells.
-
Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine beta-synthase: a target for neuronal antioxidant defense.
Zhong WX, Wang YB, Peng L, Ge XZ, Zhang J, Liu SS, Zhang XN, Xu ZH, Chen Z, Luo JH.
The Journal of Biological Chemistry 2012 Oct; 287(41):34189.
Application：WB, Human, Mouse, Neuron, HEK293 cells.
-
LANCL1, a cell surface protein, promotes liver tumor initiation through FAM49B-Rac1 axis to suppress oxidative stress.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com