Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RTN3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00010313-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RTN3 protein.
  • Immunogen:
  • RTN3 (NP_006045.1, 1 a.a. ~ 236 a.a) full-length human protein.
  • Sequence:
  • MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RTN3 expression in transfected 293T cell line (H00010313-T01) by RTN3 MaxPab polyclonal antibody.

    Lane 1: RTN3 transfected lysate(25.96 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RTN3
  • Gene Alias:
  • ASYIP,HAP,NSPL2,NSPLII,RTN3-A1
  • Gene Description:
  • reticulon 3
  • Gene Summary:
  • The reticulons are a group of highly conserved genes with preferential expression in neuroendocrine tissues (see, e.g., RTN1; MIM 600865).[supplied by OMIM
  • Other Designations:
  • ASY interacting protein,NSP-like protein II,homolog of ASY protein,isoforme III,isoforme VI,neuroendocrine-specific protein-like 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook