Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCIRG1 polyclonal antibody (A01)

  • Catalog # : H00010312-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TCIRG1.
  • Immunogen:
  • TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • TCIRG1
  • Gene Alias:
  • ATP6N1C,ATP6V0A3,Atp6i,OC-116kDa,OC116,OPTB1,Stv1,TIRC7,Vph1,a3
  • Gene Description:
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
  • Gene Summary:
  • Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq
  • Other Designations:
  • ATPase, H+ transporting, 116kD,T cell immune response cDNA7 protein,T-cell immune regulator 1,T-cell, immune regulator 1,T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3,T-cell, immune regulator 1, ATPase, H+ transporting, lyso
  • RSS
  • YouTube
  • Linkedin
  • Facebook