Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APEG1 (Human) Recombinant Protein (P01)

  • Catalog # : H00010290-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APEG1 full-length ORF ( AAH06346, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.17
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010290-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SPEG
  • Gene Alias:
  • APEG1,BPEG,KIAA1297,MGC12676,SPEGalpha,SPEGbeta
  • Gene Description:
  • SPEG complex locus
  • Gene Summary:
  • Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000064868,aortic preferentially expressed gene 1,aortic preferentially expressed protein 1,nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury,striated muscle preferentially expressed protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook