APEG1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human APEG1 full-length ORF ( AAH06346, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.17
Interspecies Antigen Sequence
Mouse (94); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SPEG
Entrez GeneID
10290GeneBank Accession#
BC006346Protein Accession#
AAH06346Gene Name
SPEG
Gene Alias
APEG1, BPEG, KIAA1297, MGC12676, SPEGalpha, SPEGbeta
Gene Description
SPEG complex locus
Gene Ontology
HyperlinkGene Summary
Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. [provided by RefSeq
Other Designations
OTTHUMP00000064868|aortic preferentially expressed gene 1|aortic preferentially expressed protein 1|nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury|striated muscle preferentially expressed protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com