APEG1 monoclonal antibody (M01), clone 2C2-2C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SPEG expression in transfected 293T cell line by APEG1 monoclonal antibody (M01), clone S2.
Lane 1: SPEG transfected lysate (Predicted MW: 12.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APEG1 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.17 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant APEG1.
Immunogen
APEG1 (AAH06346, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.17 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPEG expression in transfected 293T cell line by APEG1 monoclonal antibody (M01), clone S2.
Lane 1: SPEG transfected lysate (Predicted MW: 12.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APEG1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — SPEG
Entrez GeneID
10290GeneBank Accession#
BC006346Protein Accession#
AAH06346Gene Name
SPEG
Gene Alias
APEG1, BPEG, KIAA1297, MGC12676, SPEGalpha, SPEGbeta
Gene Description
SPEG complex locus
Gene Ontology
HyperlinkGene Summary
Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. [provided by RefSeq
Other Designations
OTTHUMP00000064868|aortic preferentially expressed gene 1|aortic preferentially expressed protein 1|nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury|striated muscle preferentially expressed protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com