Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPEG purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010290-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SPEG protein.
  • Immunogen:
  • SPEG (AAH06346.1, 1 a.a. ~ 113 a.a) full-length human protein.
  • Sequence:
  • MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SPEG expression in transfected 293T cell line (H00010290-T01) by SPEG MaxPab polyclonal antibody.

    Lane 1: SPEG transfected lysate(12.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • SPEG
  • Gene Alias:
  • APEG1,BPEG,KIAA1297,MGC12676,SPEGalpha,SPEGbeta
  • Gene Description:
  • SPEG complex locus
  • Gene Summary:
  • Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000064868,aortic preferentially expressed gene 1,aortic preferentially expressed protein 1,nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury,striated muscle preferentially expressed protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook