SPEG purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SPEG protein.
Immunogen
SPEG (AAH06346.1, 1 a.a. ~ 113 a.a) full-length human protein.
Sequence
MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPEG expression in transfected 293T cell line (H00010290-T01) by SPEG MaxPab polyclonal antibody.
Lane 1: SPEG transfected lysate(12.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SPEG
Entrez GeneID
10290GeneBank Accession#
BC006346.2Protein Accession#
AAH06346.1Gene Name
SPEG
Gene Alias
APEG1, BPEG, KIAA1297, MGC12676, SPEGalpha, SPEGbeta
Gene Description
SPEG complex locus
Gene Ontology
HyperlinkGene Summary
Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. [provided by RefSeq
Other Designations
OTTHUMP00000064868|aortic preferentially expressed gene 1|aortic preferentially expressed protein 1|nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury|striated muscle preferentially expressed protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com