Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LILRB2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010288-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human LILRB2 protein.
  • Immunogen:
  • LILRB2 (AAH41708.1, 1 a.a. ~ 193 a.a) full-length human protein.
  • Sequence:
  • MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LILRB2 expression in transfected 293T cell line (H00010288-T01) by LILRB2 MaxPab polyclonal antibody.

    Lane 1: LILRB2 transfected lysate(21.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • LILRB2
  • Gene Alias:
  • CD85D,ILT4,LILRA6,LIR-2,LIR2,MIR-10,MIR10
  • Gene Description:
  • leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
  • Gene Summary:
  • This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Ig-like transcript 4,OTTHUMP00000067358,OTTHUMP00000067463,eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6,immunoglobulin-like transcript 4,leukocyte immunoglobulin-like receptor 2,leukocyte immunoglobulin-like receptor subfa
  • RSS
  • YouTube
  • Linkedin
  • Facebook