LILRB2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human LILRB2 protein.
Immunogen
LILRB2 (AAH41708.1, 1 a.a. ~ 193 a.a) full-length human protein.
Sequence
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LILRB2 expression in transfected 293T cell line (H00010288-T01) by LILRB2 MaxPab polyclonal antibody.
Lane 1: LILRB2 transfected lysate(21.23 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LILRB2
Entrez GeneID
10288GeneBank Accession#
BC041708.1Protein Accession#
AAH41708.1Gene Name
LILRB2
Gene Alias
CD85D, ILT4, LILRA6, LIR-2, LIR2, MIR-10, MIR10
Gene Description
leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
Omim ID
604815Gene Ontology
HyperlinkGene Summary
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Ig-like transcript 4|OTTHUMP00000067358|OTTHUMP00000067463|eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6|immunoglobulin-like transcript 4|leukocyte immunoglobulin-like receptor 2|leukocyte immunoglobulin-like receptor subfa
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com