SMNDC1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in human placenta.
Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in PC-12.
Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in NIH/3T3.
Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in A-431.
Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in Raw 264.7.
Western Blot (Transfected lysate)
Western Blot analysis of SMNDC1 expression in transfected 293T cell line (H00010285-T01) by SMNDC1 MaxPab polyclonal antibody.
Lane 1: SMNDC1 transfected lysate(26.18 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SMNDC1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SMNDC1 protein.
Immunogen
SMNDC1 (NP_005862.1, 1 a.a. ~ 238 a.a) full-length human protein.
Sequence
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in human placenta.Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in PC-12.Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in NIH/3T3.Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in A-431.Western Blot (Cell lysate)
SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of SMNDC1 expression in transfected 293T cell line (H00010285-T01) by SMNDC1 MaxPab polyclonal antibody.
Lane 1: SMNDC1 transfected lysate(26.18 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SMNDC1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SMNDC1
Entrez GeneID
10285GeneBank Accession#
NM_005871Protein Accession#
NP_005862.1Gene Name
SMNDC1
Gene Alias
SMNR, SPF30
Gene Description
survival motor neuron domain containing 1
Omim ID
603519Gene Ontology
HyperlinkGene Summary
This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. [provided by RefSeq
Other Designations
OTTHUMP00000020474|OTTHUMP00000020475|SMN-related protein|splicing factor 30, survival of motor neuron-related
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com