Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMNDC1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00010285-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SMNDC1 protein.
  • Immunogen:
  • SMNDC1 (NP_005862.1, 1 a.a. ~ 238 a.a) full-length human protein.
  • Sequence:
  • MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in human placenta.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in A-431.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMNDC1 MaxPab polyclonal antibody. Western Blot analysis of SMNDC1 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SMNDC1 expression in transfected 293T cell line (H00010285-T01) by SMNDC1 MaxPab polyclonal antibody.

    Lane 1: SMNDC1 transfected lysate(26.18 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • SMNDC1
  • Gene Alias:
  • SMNR,SPF30
  • Gene Description:
  • survival motor neuron domain containing 1
  • Gene Summary:
  • This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020474,OTTHUMP00000020475,SMN-related protein,splicing factor 30, survival of motor neuron-related
  • RSS
  • YouTube
  • Linkedin
  • Facebook