SAP18 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SAP18 protein.
Immunogen
SAP18 (NP_005861.1, 1 a.a. ~ 153 a.a) full-length human protein.
Sequence
MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunoprecipitation
Immunoprecipitation of SAP18 transfected lysate using anti-SAP18 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAP18 purified MaxPab mouse polyclonal antibody (B01P) (H00010284-B01P). -
Gene Info — SAP18
Entrez GeneID
10284GeneBank Accession#
NM_005870.3Protein Accession#
NP_005861.1Gene Name
SAP18
Gene Alias
2HOR0202, MGC27131, SAP18P
Gene Description
Sin3A-associated protein, 18kDa
Omim ID
602949Gene Ontology
HyperlinkGene Summary
Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2. [provided by RefSeq
Other Designations
OTTHUMP00000018107|cell growth inhibiting protein 38|histone deacetlyase complex subunit SAP18|sin3-associated polypeptide, p18
-
Interactome
-
Publication Reference
-
Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA.
Cell Cycle 2012 Jun; 11(12):2367.
Application:WB, IP, Human, SCC cell.
-
Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com