Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DSCR4 (Human) Recombinant Protein (P01)

  • Catalog # : H00010281-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DSCR4 full-length ORF ( ADR82732.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 13
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DSCR4
  • Gene Alias:
  • DCRB,DSCRB
  • Gene Description:
  • Down syndrome critical region gene 4
  • Gene Summary:
  • The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5 Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and mental retardation. This gene is found in this region and multiple transcripts may exist. It is mainly expressed in the placenta. [provided by RefSeq
  • Other Designations:
  • Down syndrome critical region protein 4,Down syndrome critical region protein B
  • RSS
  • YouTube
  • Linkedin
  • Facebook