Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OPRS1 (Human) Recombinant Protein (P01)

  • Catalog # : H00010280-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human OPRS1 full-length ORF ( NP_005857.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010280-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SIGMAR1
  • Gene Alias:
  • FLJ25585,MGC3851,OPRS1,SR-BP1
  • Gene Description:
  • sigma non-opioid intracellular receptor 1
  • Gene Summary:
  • This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000000515,OTTHUMP00000000516,OTTHUMP00000000517,OTTHUMP00000021286,SR31747 binding protein 1,aging-associated gene 8 protein,opioid receptor, sigma 1,sigma1 receptor,type I sigma receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook