OPRS1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human OPRS1 full-length ORF ( NP_005857.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.5
Interspecies Antigen Sequence
Mouse (90); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SIGMAR1
Entrez GeneID
10280GeneBank Accession#
NM_005866.2Protein Accession#
NP_005857.1Gene Name
SIGMAR1
Gene Alias
FLJ25585, MGC3851, OPRS1, SR-BP1
Gene Description
sigma non-opioid intracellular receptor 1
Omim ID
601978Gene Ontology
HyperlinkGene Summary
This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000000515|OTTHUMP00000000516|OTTHUMP00000000517|OTTHUMP00000021286|SR31747 binding protein 1|aging-associated gene 8 protein|opioid receptor, sigma 1|sigma1 receptor|type I sigma receptor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com