AKAP8 monoclonal antibody (M01), clone 3D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
AKAP8 monoclonal antibody (M01), clone 3D4 Western Blot analysis of AKAP8 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of AKAP8 expression in transfected 293T cell line by AKAP8 monoclonal antibody (M01), clone 3D4.
Lane 1: AKAP8 transfected lysate(76.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AKAP8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of AKAP8 transfected lysate using anti-AKAP8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKAP8 monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP8 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to AKAP8 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (38.06 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKAP8.
Immunogen
AKAP8 (NP_005849, 551 a.a. ~ 662 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAES
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.06 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AKAP8 monoclonal antibody (M01), clone 3D4 Western Blot analysis of AKAP8 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of AKAP8 expression in transfected 293T cell line by AKAP8 monoclonal antibody (M01), clone 3D4.
Lane 1: AKAP8 transfected lysate(76.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AKAP8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of AKAP8 transfected lysate using anti-AKAP8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKAP8 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP8 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to AKAP8 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — AKAP8
Entrez GeneID
10270GeneBank Accession#
NM_005858Protein Accession#
NP_005849Gene Name
AKAP8
Gene Alias
AKAP95, DKFZp586B1222
Gene Description
A kinase (PRKA) anchor protein 8
Omim ID
604692Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is located in the nucleus during interphase and is distinctly redistributed during mitosis. This protein has a cell cycle-dependent interaction with the RII subunit of PKA. [provided by RefSeq
Other Designations
A-kinase anchor protein 8|A-kinase anchor protein, 95kDa
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com