Product Browser

Last updated: 2021/8/8

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAMP3 DNAxPab DNAxPab

  • Catalog # : H00010268-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a partial-length human RAMP3 DNA using DNAx™ Immune technology.
  • Immunogen:
  • RAMP3 (NP_005847.1, 24 a.a. ~ 118 a.a) partial-length human DNA
  • Sequence:
  • RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RAMP3 expression in transfected 293T cell line by RAMP3 DNAxPab polyclonal antibody.

    Lane 1: RAMP3 transfected lysate(31.57 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Gene Name:
  • RAMP3
  • Gene Alias:
  • -
  • Gene Description:
  • receptor (G protein-coupled) activity modifying protein 3
  • Gene Summary:
  • The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor. [provided by RefSeq
  • Other Designations:
  • calcitonin receptor-like receptor activity modifying protein 3,receptor (calcitonin) activity modifying protein 3,receptor activity modifying protein 3,receptor-activity-modifying protein 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook