RAMP3 monoclonal antibody (M01), clone 1C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAMP3 monoclonal antibody (M01), clone 1C11. Western Blot analysis of RAMP3 expression in Jurkat.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAMP3 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (39.49 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RAMP3.
Immunogen
RAMP3 (AAH22304.1, 24 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.49 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAMP3 monoclonal antibody (M01), clone 1C11. Western Blot analysis of RAMP3 expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAMP3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RAMP3
Entrez GeneID
10268GeneBank Accession#
BC022304Protein Accession#
AAH22304.1Gene Name
RAMP3
Gene Alias
-
Gene Description
receptor (G protein-coupled) activity modifying protein 3
Omim ID
605155Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor. [provided by RefSeq
Other Designations
calcitonin receptor-like receptor activity modifying protein 3|receptor (calcitonin) activity modifying protein 3|receptor activity modifying protein 3|receptor-activity-modifying protein 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com