CDK2AP2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CDK2AP2 protein.
Immunogen
CDK2AP2 (AAH02850, 1 a.a. ~ 126 a.a) full-length human protein.
Sequence
MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDK2AP2 MaxPab polyclonal antibody. Western Blot analysis of CDK2AP2 expression in Hela S3 NE.Western Blot (Cell lysate)
CDK2AP2 MaxPab polyclonal antibody. Western Blot analysis of CDK2AP2 expression in Raw 264.7.Western Blot (Cell lysate)
CDK2AP2 MaxPab polyclonal antibody. Western Blot analysis of CDK2AP2 expression in PC-12.Western Blot (Cell lysate)
CDK2AP2 MaxPab polyclonal antibody. Western Blot analysis of CDK2AP2 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of CDK2AP2 expression in transfected 293T cell line (H00010263-T01) by CDK2AP2 MaxPab polyclonal antibody.
Lane 1: CDK2AP2 transfected lysate(13.86 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CDK2AP2
Entrez GeneID
10263GeneBank Accession#
BC002850Protein Accession#
AAH02850Gene Name
CDK2AP2
Gene Alias
DOC-1R, FLJ10636, p14
Gene Description
cyclin-dependent kinase 2 associated protein 2
Gene Ontology
HyperlinkOther Designations
CDK2-associated protein 2|tumor suppressor deleted in oral cancer related 1|tumor suppressor deleted in oral cancer-related 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com