SF3B4 monoclonal antibody (M03), clone 1B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SF3B4.
Immunogen
SF3B4 (NP_005841.1, 13 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SF3B4 expression in transfected 293T cell line by SF3B4 monoclonal antibody (M03), clone 1B8.
Lane 1: SF3B4 transfected lysate(44.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SF3B4 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SF3B4
Entrez GeneID
10262GeneBank Accession#
NM_005850Protein Accession#
NP_005841.1Gene Name
SF3B4
Gene Alias
MGC10828, SAP49, SF3b49
Gene Description
splicing factor 3b, subunit 4, 49kDa
Omim ID
605593Gene Ontology
HyperlinkGene Summary
This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA. [provided by RefSeq
Other Designations
OTTHUMP00000014064|pre-mRNA splicing factor SF3b 49 kDa subunit|spliceosomal protein|spliceosome-associated protein (U2 snRNP)|splicing factor 3b, subunit 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com