Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CNKSR1 polyclonal antibody (A01)

  • Catalog # : H00010256-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CNKSR1.
  • Immunogen:
  • CNKSR1 (NP_006305, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VLCAAVELLHEADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010256-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CNKSR1 polyclonal antibody (A01), Lot # 060501JCS1 Western Blot analysis of CNKSR1 expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CNKSR1
  • Gene Alias:
  • CNK,CNK1,KSR
  • Gene Description:
  • connector enhancer of kinase suppressor of Ras 1
  • Gene Summary:
  • This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008767,connector enhancer of KSR-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook