STAM2 monoclonal antibody (M01), clone 1A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STAM2 monoclonal antibody (M01), clone 1A10 Western Blot analysis of STAM2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of STAM2 expression in transfected 293T cell line by STAM2 monoclonal antibody (M01), clone 1A10.
Lane 1: STAM2 transfected lysate (Predicted MW: 58.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of STAM2 transfected lysate using anti-STAM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STAM2 monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAM2 is approximately 10ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STAM2.
Immunogen
STAM2 (NP_005834, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STAM2 monoclonal antibody (M01), clone 1A10 Western Blot analysis of STAM2 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STAM2 expression in transfected 293T cell line by STAM2 monoclonal antibody (M01), clone 1A10.
Lane 1: STAM2 transfected lysate (Predicted MW: 58.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of STAM2 transfected lysate using anti-STAM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STAM2 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAM2 is approximately 10ng/ml as a capture antibody.ELISA
-
Gene Info — STAM2
Entrez GeneID
10254GeneBank Accession#
NM_005843Protein Accession#
NP_005834Gene Name
STAM2
Gene Alias
DKFZp564C047, Hbp, STAM2A, STAM2B
Gene Description
signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
Omim ID
606244Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is closely related to STAM, an adaptor protein involved in the downstream signaling of cytokine receptors, both of which contain a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). Similar to STAM, this protein acts downstream of JAK kinases, and is phosphorylated in response to cytokine stimulation. This protein and STAM thus are thought to exhibit compensatory effects on the signaling pathway downstream of JAK kinases upon cytokine stimulation. [provided by RefSeq
Other Designations
Hrs-binding protein|STAM-like protein containing SH3 and ITAM domains 2|signal transducing adaptor molecule 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com