Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POP7 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00010248-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human POP7 protein.
  • Immunogen:
  • POP7 (AAH01430, 1 a.a. ~ 140 a.a) full-length human protein.
  • Sequence:
  • MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POP7 expression in transfected 293T cell line by POP7 MaxPab polyclonal antibody.

    Lane 1: POP7 transfected lysate(15.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • POP7
  • Gene Alias:
  • 0610037N12Rik,RPP2,RPP20
  • Gene Description:
  • processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
  • Other Designations:
  • POP7 (processing of precursor, S. cerevisiae) homolog,processing of precursor 7, ribonuclease P subunit,processing of precursor 7, ribonuclease P/MRP subunit,ribonuclease P protein subunit p20
  • RSS
  • YouTube
  • Linkedin
  • Facebook