KCNMB2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNMB2 full-length ORF ( AAH17825, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMTVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKGVILTKLYSSSVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.59
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNMB2
Entrez GeneID
10242GeneBank Accession#
BC017825Protein Accession#
AAH17825Gene Name
KCNMB2
Gene Alias
MGC22431
Gene Description
potassium large conductance calcium-activated channel, subfamily M, beta member 2
Omim ID
605214Gene Ontology
HyperlinkGene Summary
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Two variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
MaxiK channel beta 2 subunit|calcium-activated potassium channel beta 2 subunit|large conductance calcium-activated potassium channel beta 2 subunit|large-conductance Ca2+-activated K+ channel beta2 subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com