Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNMB2 (Human) Recombinant Protein (P01)

  • Catalog # : H00010242-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNMB2 full-length ORF ( AAH17825, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMTVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKGVILTKLYSSSVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.59
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010242-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • KCNMB2
  • Gene Alias:
  • MGC22431
  • Gene Description:
  • potassium large conductance calcium-activated channel, subfamily M, beta member 2
  • Gene Summary:
  • MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Two variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • MaxiK channel beta 2 subunit,calcium-activated potassium channel beta 2 subunit,large conductance calcium-activated potassium channel beta 2 subunit,large-conductance Ca2+-activated K+ channel beta2 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook