Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RASGRP2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010235-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RASGRP2 partial ORF ( NP_005816, 65 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010235-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RASGRP2
  • Gene Alias:
  • CALDAG-GEFI,CDC25L
  • Gene Description:
  • RAS guanyl releasing protein 2 (calcium and DAG-regulated)
  • Gene Summary:
  • The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Three alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000042931,OTTHUMP00000069245,OTTHUMP00000069246,RAS guanyl nucleotide-releasing protein 2,RAS guanyl releasing protein 2,calcium and DAG-regulated guanine nucleotide exchange factor I,calcium and diacylglycerol-regulated guanine nucleotide exchan
  • RSS
  • YouTube
  • Linkedin
  • Facebook