RASGRP2 monoclonal antibody (M09), clone 3D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RASGRP2.
Immunogen
RASGRP2 (NP_005816, 65 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RASGRP2 expression in transfected 293T cell line by RASGRP2 monoclonal antibody (M09), clone 3D8.
Lane 1: RASGRP2 transfected lysate(75.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RASGRP2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — RASGRP2
Entrez GeneID
10235GeneBank Accession#
NM_005825Protein Accession#
NP_005816Gene Name
RASGRP2
Gene Alias
CALDAG-GEFI, CDC25L
Gene Description
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Omim ID
605577Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Three alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000042931|OTTHUMP00000069245|OTTHUMP00000069246|RAS guanyl nucleotide-releasing protein 2|RAS guanyl releasing protein 2|calcium and DAG-regulated guanine nucleotide exchange factor I|calcium and diacylglycerol-regulated guanine nucleotide exchan
-
Interactome
-
Pathway
-
Publication Reference
-
Calcium-Diacylglycerol Guanine Nucleotide Exchange Factor I (CalDAG-GEFI) gene mutations associated with loss of function in canine platelets.
Boudreaux MK, Catalfamo JL, Klok M.
Translational Research 2007 May; 150(2):81.
Application:WB, Canine, Human and canine blood.
-
Calcium-Diacylglycerol Guanine Nucleotide Exchange Factor I (CalDAG-GEFI) gene mutations associated with loss of function in canine platelets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com