Product Browser

Last updated: 2017/10/15
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RCAN2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00010231-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RCAN2 protein.
  • Immunogen:
  • RCAN2 (AAH38509.1, 1 a.a. ~ 225 a.a) full-length human protein.
  • Sequence:
  • MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RCAN2 expression in transfected 293T cell line (H00010231-T01) by RCAN2 MaxPab polyclonal antibody.

    Lane 1: DSCR1L1 transfected lysate(24.75 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RCAN2
  • Gene Alias:
  • CSP2,DSCR1L1,MCIP2,RCN2,ZAKI-4,ZAKI4,hRCN2
  • Gene Description:
  • regulator of calcineurin 2
  • Other Designations:
  • Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndrome candidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein 2) (MCIP2),Down syndrome candidate region 1-like 1,Down syndrome critical region gene 1-like 1,Down synd
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook