Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COQ7 (Human) Recombinant Protein (P01)

  • Catalog # : H00010229-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human COQ7 full-length ORF ( NP_057222.2, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010229-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • COQ7
  • Gene Alias:
  • CAT5,CLK-1,CLK1
  • Gene Description:
  • coenzyme Q7 homolog, ubiquinone (yeast)
  • Gene Summary:
  • The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Transcript variants have been described for this gene, but their full-length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • COQ7 coenzyme Q, 7 homolog ubiquinone,COQ7 protein,placental protein KG-20,timing protein,ubiquinone biosynthesis protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook