Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KLRG1 (Human) Recombinant Protein (P01)

  • Catalog # : H00010219-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KLRG1 full-length ORF ( NP_005801.3, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010219-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • KLRG1
  • Gene Alias:
  • 2F1,CLEC15A,MAFA,MAFA-2F1,MAFA-L,MAFA-LIKE,MGC13600
  • Gene Description:
  • killer cell lectin-like receptor subfamily G, member 1
  • Gene Summary:
  • Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. Alternatively spliced transcript variants have been reported, but their full-length natures have not yet been determined. [provided by RefSeq
  • Other Designations:
  • C-type lectin domain family 15, member A,mast cell function-associated antigen (ITIM-containing)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook