PRG4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRG4 partial ORF ( NP_005798, 1305 a.a. - 1404 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRG4
Entrez GeneID
10216GeneBank Accession#
NM_005807Protein Accession#
NP_005798Gene Name
PRG4
Gene Alias
CACP, FLJ32635, HAPO, JCAP, MSF, SZP, bG174L6.2
Gene Description
proteoglycan 4
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000033580|articular superficial zone protein|bG174L6.2 (MSF: megakaryocyte stimulating factor )|lubricin|megakaryocyte stimulating factor
-
Interactome
-
Publication Reference
-
Cardioprotective proteins upregulated in the liver in response to experimental myocardial ischemia.
Liu SQ, Tefft BJ, Roberts DT, Zhang LQ, Ren Y, Li YC, Huang Y, Zhang D, Phillips HR, Wu YH.
American Journal of Physiology. Heart and Circulatory Physiology 2012 Oct; 303(12):H1446.
Application:ELISA, Mouse, Mouse serum.
-
Cardioprotective proteins upregulated in the liver in response to experimental myocardial ischemia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com